Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q2

Expression Region

1-84

Origin

Bovine coronavirus (strain LSU-94LSS-051) (BCoV-LSU) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL
BNC941019-100 1x 100 µL

CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF740 conjugate, 0.1mg/mL
BNC742924-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRK5 Human Gene Knockout Kit (CRISPR)
KN209137BN 1 Kit

GRK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Jagged 1 Rabbit Polyclonal Antibody
R1706-10 100 µL

Jagged 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS620271 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Trpm5 Mouse Gene Knockout Kit (CRISPR)
KN518302 1 Kit

Trpm5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details