Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q5

Expression Region

1-84

Origin

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR43 (C-Term) Rabbit pAb
MBS8554491-01 0.1 mL

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
WDR43 (C-Term) Rabbit pAb
MBS8554491-02 0.1 mL (AF405L)

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
WDR43 (C-Term) Rabbit pAb
MBS8554491-03 0.1 mL (AF405S)

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
WDR43 (C-Term) Rabbit pAb
MBS8554491-04 0.1 mL (AF610)

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
WDR43 (C-Term) Rabbit pAb
MBS8554491-05 0.1 mL (AF635)

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
WDR43 (C-Term) Rabbit pAb
MBS8554491-06 0.1 mL (APC)

WDR43 (C-Term) Rabbit pAb

Sign In for Pricing
View Details