Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q5

Expression Region

1-84

Origin

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBR1 (NM_031862) Human Tagged Lenti ORF Clone
RC215342L4 10 µg

NBR1 (NM_031862) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Vmn1r192 Mouse siRNA Oligo Duplex (Locus ID 252907)
SR408750 1 Kit

Vmn1r192 Mouse siRNA Oligo Duplex (Locus ID 252907)

Sign In for Pricing
View Details
Maltooctaose
sc-286149 100 mg

Maltooctaose

Sign In for Pricing
View Details
PPIAL4G CRISPR Activation Plasmid (h)
sc-417868-ACT 20 µg

PPIAL4G CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
L-Glutamine alpha-amide hydrochloride
278533-01 500 mg

L-Glutamine alpha-amide hydrochloride

Sign In for Pricing
View Details
L-Glutamine alpha-amide hydrochloride
278533-02 1 g

L-Glutamine alpha-amide hydrochloride

Sign In for Pricing
View Details