Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q4

Expression Region

1-84

Origin

Bovine coronavirus (strain LY-138) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB5R1 Polyclonal Antibody
A58706-100 100 µL

CYB5R1 Polyclonal Antibody

Sign In for Pricing
View Details
C4orf46 Lentiviral Activation Particles (h)
sc-417219-LAC 200 µL

C4orf46 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PLCG1 Polyclonal Antibody
RD266542A-01 60μL

PLCG1 Polyclonal Antibody

Sign In for Pricing
View Details
PLCG1 Polyclonal Antibody
RD266542A-02 120μL

PLCG1 Polyclonal Antibody

Sign In for Pricing
View Details
PLCG1 Polyclonal Antibody
RD266542A-03 200μL

PLCG1 Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Histone Deacetylase 6 ELISA Kit
MBS096349-01 48 Well

Monkey Histone Deacetylase 6 ELISA Kit

Sign In for Pricing
View Details