Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q6

Expression Region

1-84

Origin

Bovine coronavirus (strain Ontario) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOXL2 Mouse Monoclonal Antibody [Clone ID: OTI4H3]
CF807444 100 µg

LOXL2 Mouse Monoclonal Antibody [Clone ID: OTI4H3]

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Grik4 Mouse Gene Knockout Kit (CRISPR)
KN307327RB 1 Kit

Grik4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Gdf5 activation kit by CRISPRa
GA201583 1 Kit

Mouse Gdf5 activation kit by CRISPRa

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), CF488A conjugate, 0.1mg/mL
BNC881727-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPCAM Rabbit Polyclonal Antibody
TA366488 100 µL

EPCAM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details