Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q6

Expression Region

1-84

Origin

Bovine coronavirus (strain Ontario) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Phenyl-2-butanamine
TRC-P400128-50MG 50 mg

1-Phenyl-2-butanamine

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560848 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CCDC43 Antibody
KC-42846-01 50 μL

CCDC43 Antibody

Sign In for Pricing
View Details
CCDC43 Antibody
KC-42846-02 100 µL

CCDC43 Antibody

Sign In for Pricing
View Details
CCDC43 Antibody
KC-42846-03 1 mL

CCDC43 Antibody

Sign In for Pricing
View Details
GRK2 (Ab-29) Antibody
8B0486-AAT 50 µg

GRK2 (Ab-29) Antibody

Sign In for Pricing
View Details