Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P0C2Q6

Expression Region

1-84

Origin

Bovine coronavirus (strain Ontario) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (TB28-2), 0.2mg/mL
BNUB0708-500 1x 500 µL

Kappa Light Chain (TB28-2), 0.2mg/mL

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL
BNC942394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701728 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human PVRL4 (NECTIN4) activation kit by CRISPRa
GA113085 1 Kit

Human PVRL4 (NECTIN4) activation kit by CRISPRa

Sign In for Pricing
View Details
Argonaute 4 (AGO4) (NM_017629) Human Over-expression Lysate
LY402604 100 µg

Argonaute 4 (AGO4) (NM_017629) Human Over-expression Lysate

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF568 conjugate, 0.1mg/mL
BNC683243-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details