Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P15779

Expression Region

1-84

Origin

Bovine coronavirus (strain Mebus) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLGLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genesig Real-Time PCR detection kit for Yersinia enterocolitica, Standard
349608 1 Kit

Genesig Real-Time PCR detection kit for Yersinia enterocolitica, Standard

Sign In for Pricing
View Details
STAT3 antibody
BF0354 100 µg

STAT3 antibody

Sign In for Pricing
View Details
JAB1 rabbit pAb
ES2654-01 50 µL

JAB1 rabbit pAb

Sign In for Pricing
View Details
JAB1 rabbit pAb
ES2654-02 100 µL

JAB1 rabbit pAb

Sign In for Pricing
View Details
Monkey TLR2 (Toll-Like Receptor 2) QuickTest ELISA Kit
QT-EMK0077 96 Tests

Monkey TLR2 (Toll-Like Receptor 2) QuickTest ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Boydii anmK Protein (aa 1-369)
VAng-Lsx08531-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii anmK Protein (aa 1-369)

Sign In for Pricing
View Details