Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P15779

Expression Region

1-84

Origin

Bovine coronavirus (strain Mebus) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLGLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ifitm3 shRNA (UAS) - Lentiviral mouse Ifitm3 shRNA (UAS) (25)
GTR15244961 1 Vial

Lentiviral mouse Ifitm3 shRNA (UAS) - Lentiviral mouse Ifitm3 shRNA (UAS) (25)

Sign In for Pricing
View Details
IRF7 Polyclonal Antibody
E11-200057 100 µg -100 µL

IRF7 Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI9F3]
TA811386S 30 µL

PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI9F3]

Sign In for Pricing
View Details
Lentiviral human TBC1D16 shRNA (UAS) - Lentiviral human TBC1D16 shRNA (UAS) (25)
GTR15151181 1 Vial

Lentiviral human TBC1D16 shRNA (UAS) - Lentiviral human TBC1D16 shRNA (UAS) (25)

Sign In for Pricing
View Details
IGFBP-1 (Insulin-Like Growth Factor Binding Protein 1) Rat ELISA Kit
E1843 96 Tests

IGFBP-1 (Insulin-Like Growth Factor Binding Protein 1) Rat ELISA Kit

Sign In for Pricing
View Details
GLOD4 Protein Lysate
OCOA10394-20UG 20 µg

GLOD4 Protein Lysate

Sign In for Pricing
View Details