Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P15775

Expression Region

1-84

Origin

Bovine coronavirus (strain F15) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNO1 Human qPCR Template Standard (NM_020143)
HK210779 1 Kit

PNO1 Human qPCR Template Standard (NM_020143)

Sign In for Pricing
View Details
Human MUC7 activation kit by CRISPRa
GA103038 1 Kit

Human MUC7 activation kit by CRISPRa

Sign In for Pricing
View Details
Delicious Peptide
070-21 5 mg

Delicious Peptide

Sign In for Pricing
View Details
CREM Polyclonal Antibody, PE-Cy5 Conjugated
bs-5135R-PE-Cy5 100 µL

CREM Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
IL12A sgRNA CRISPR Lentivector (Human) (Target 3)
K1078704 1.0 µg DNA

IL12A sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phaseolus limensis (LBA) (FITC) discontinued
518610 2 mg

Phaseolus limensis (LBA) (FITC) discontinued

Sign In for Pricing
View Details