Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P15775

Expression Region

1-84

Origin

Bovine coronavirus (strain F15) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF157 Antibody - N-terminal region : HRP (ARP57911_P050-HRP)
ARP57911_P050-HRP 100 µL

ZNF157 Antibody - N-terminal region : HRP (ARP57911_P050-HRP)

Sign In for Pricing
View Details
RT1-T18 AAV Vector (Rat) (CMV)
42852106 1 µg

RT1-T18 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Plant Guanosine 5-Triphosphate Cyclohydrolase1 (GCH1) ELISA Kit
MBS9380456 Inquire

Plant Guanosine 5-Triphosphate Cyclohydrolase1 (GCH1) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 55989/EAEC) MSCL Polyclonal Antibody
MBS7176079 Inquire

Rabbit anti-Escherichia coli (strain 55989/EAEC) MSCL Polyclonal Antibody

Sign In for Pricing
View Details
STAT3-IN-1
S0818-5mg 5 mg

STAT3-IN-1

Sign In for Pricing
View Details
Recombinant Human EIF4E Protein
E30P60784A 50 µg

Recombinant Human EIF4E Protein

Sign In for Pricing
View Details