Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Envelope small membrane protein (E)

This Recombinant Bovine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-84.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P15775

Expression Region

1-84

Origin

Bovine coronavirus (strain F15) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB1 Rabbit Polyclonal Antibody
E10G05831 100 µL

TGFB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCMF1 Peptide (AAP32921)
AAP32921-100UG 100 µg

KCMF1 Peptide (AAP32921)

Sign In for Pricing
View Details
FNDR-20123
BA2164-5.1 1 mL (10 mM in DMSO)

FNDR-20123

Sign In for Pricing
View Details
Biotinylated Recombinant Human IL-017A&IL-017F heterodimer Protein, Avi His Tag
KMP2028 100 µg

Biotinylated Recombinant Human IL-017A&IL-017F heterodimer Protein, Avi His Tag

Sign In for Pricing
View Details
EAU PLUVIALE 250X26CARD-T1-P16 Pipe Markers for Water
N003425 4 Card (4 Marker (s) x 1 Card)

EAU PLUVIALE 250X26CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Golgin 97 Antibody
MBS9612162-01 0.1 mL

Golgin 97 Antibody

Sign In for Pricing
View Details