Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Uncharacterized protein HI_0974.1 (HI_0974.1)

This Recombinant Haemophilus influenzae Uncharacterized protein HI_0974.1 (HI_0974.1) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein HI_0974.1

UniProt

P46455

Expression Region

1-85

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLKQRYQQAGKEASWALSLSILYVIGWCLCAYLPKETQGPIGFPLWFELSCIYLPILFI VIGHWIIKIIFQDISLEINDQGNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF488A conjugate, 0.1mg/mL
BNC880955-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details