Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana ATP synthase subunit 9, mitochondrial (ATP9)

This Recombinant Arabidopsis thaliana ATP synthase subunit 9, mitochondrial (ATP9) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit 9, mitochondrial, Lipid-binding protein

UniProt

P60112

Expression Region

1-85

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKREYNSQPEMLEGAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYA ILGFALTEAIALFALMMAFLILFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL
BNC401858-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/1094), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL
BNC400478-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (Ks19.1), CF405S conjugate, 0.1mg/mL
BNC040394-500 1x 500 µL

Cytokeratin 19 (Ks19.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details