Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ)

This Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64445

Expression Region

1-85

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAR1B (NM_001033503) Human Over-expression Lysate
LC422370 20 µg

SAR1B (NM_001033503) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF79 (NM_001286697) Human Tagged ORF Clone
RG238436 10 µg

ZNF79 (NM_001286697) Human Tagged ORF Clone

Sign In for Pricing
View Details
BAD Rabbit Polyclonal Antibody
AP02605PU-N 100 µL

BAD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human BLK Protein (His Tag)
PKSH032011-01 10 µg

Recombinant Human BLK Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BLK Protein (His Tag)
PKSH032011-02 50 µg

Recombinant Human BLK Protein (His Tag)

Sign In for Pricing
View Details
GPR34 Human qPCR Primer Pair (NM_005300)
HP231883 200 Reactions

GPR34 Human qPCR Primer Pair (NM_005300)

Sign In for Pricing
View Details