Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ)

This Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64445

Expression Region

1-85

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Betaine Aldehyde Chloride
TRC-B325000-5MG 5 mg

Betaine Aldehyde Chloride

Sign In for Pricing
View Details
GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI7B8]
CF810250 100 µg

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI7B8]

Sign In for Pricing
View Details
IFluor® 568 Styramide
45030-AAT 100 Slides

IFluor® 568 Styramide

Sign In for Pricing
View Details
OR6C3 Human Gene Knockout Kit (CRISPR)
KN424404 1 Kit

OR6C3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tris-Tricine -SDS Buffer (10X)
EC-869 1 L

Tris-Tricine -SDS Buffer (10X)

Sign In for Pricing
View Details
PNMA8B Human Gene Knockout Kit (CRISPR)
KN213508BN 1 Kit

PNMA8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details