Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ)

This Recombinant Escherichia coli Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64445

Expression Region

1-85

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVA1 (MPZL2) (NM_144765) Human Recombinant Protein
TP323753M 100 µg

EVA1 (MPZL2) (NM_144765) Human Recombinant Protein

Sign In for Pricing
View Details
MDH2 Human Knockdown Lysate
LY300240 100 µg

MDH2 Human Knockdown Lysate

Sign In for Pricing
View Details
PAPSS2 (C-term) Rabbit Polyclonal Antibody
AP15046PU-N 400 µL

PAPSS2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP63 (NM_001042400) Human Over-expression Lysate
LC420878 20 µg

CEP63 (NM_001042400) Human Over-expression Lysate

Sign In for Pricing
View Details
Tropomyosin 3 (TPM3) (NM_001043353) Human Over-expression Lysate
LY420818 100 µg

Tropomyosin 3 (TPM3) (NM_001043353) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NETO2 activation kit by CRISPRa
GA113125 1 Kit

Human NETO2 activation kit by CRISPRa

Sign In for Pricing
View Details