Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ynaJ (ynaJ)

This Recombinant Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64446

Expression Region

1-85

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51L3 ORF Vector (Human) (pORF)
ORF008552 1.0 µg DNA

RAD51L3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PTBP2 Peptide
46-244P 0.1 mg

PTBP2 Peptide

Sign In for Pricing
View Details
Recombinant Human Lacritin/LACRT Protein, His Tag
E40KMH1315 20 µg

Recombinant Human Lacritin/LACRT Protein, His Tag

Sign In for Pricing
View Details
CGBP (13M12) Rabbit Monoclonal Antibody
E28M2625 100 µL

CGBP (13M12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone 13C9]
E45M21388V-2 50 µL

REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone 13C9]

Sign In for Pricing
View Details
COX5b (W10)
sc-100523 100 µg/mL

COX5b (W10)

Sign In for Pricing
View Details