Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ynaJ (ynaJ)

This Recombinant Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64446

Expression Region

1-85

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-9b-5p inhibitor
HY-RI04601-01 5 nmol

Rno-miR-9b-5p inhibitor

Sign In for Pricing
View Details
Rno-miR-9b-5p inhibitor
HY-RI04601-02 20 nmol

Rno-miR-9b-5p inhibitor

Sign In for Pricing
View Details
Recombinant human NRG1 Protein, C-hFc & His (HEK293)
bs-47284P-01 20 µg

Recombinant human NRG1 Protein, C-hFc & His (HEK293)

Sign In for Pricing
View Details
Recombinant human NRG1 Protein, C-hFc & His (HEK293)
bs-47284P-02 50 µg

Recombinant human NRG1 Protein, C-hFc & His (HEK293)

Sign In for Pricing
View Details
Recombinant human NRG1 Protein, C-hFc & His (HEK293)
bs-47284P-03 100 µg

Recombinant human NRG1 Protein, C-hFc & His (HEK293)

Sign In for Pricing
View Details
omniPAGE Maxi Plus, 30 x 22cm Dual Caster.
VS30DCAST 1 Unit

omniPAGE Maxi Plus, 30 x 22cm Dual Caster.

Sign In for Pricing
View Details