Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ynaJ (ynaJ)

This Recombinant Uncharacterized protein ynaJ (ynaJ) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein ynaJ

UniProt

P64447

Expression Region

1-85

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI FVYSLVFTVLLAIPLGIYFLGGEEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-01 0.1 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-02 0.2 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-03 0.5 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-04 1 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-05 5 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)
MBS2046894-06 5x 5 mL

PE-Linked Polyclonal Antibody to Cyclic ADP Ribose Hydrolase (cADPRH)

Sign In for Pricing
View Details