Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

A8WUS5

Expression Region

1-85

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASQLIIYSAHVVLLVLVWLLAYTEVVPVLSYIPECAHCLVYYIYAAFNVIYGVATFNDC AEAKVELLQEIKQARAELKQKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ASC/TMS1 Antibody [Alexa Fluor 594]
NBP1-78977AF594 0.1 mL

Rabbit Polyclonal ASC/TMS1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
PDHA1 Recombinant Protein
OPCD06073-10UG 10 µg

PDHA1 Recombinant Protein

Sign In for Pricing
View Details
PWP2, ID (PWP2, PWP2H, Periodic tryptophan protein 2 homolog) (MaxLight 650)
MBS6339269-01 0.1 mL

PWP2, ID (PWP2, PWP2H, Periodic tryptophan protein 2 homolog) (MaxLight 650)

Sign In for Pricing
View Details
PWP2, ID (PWP2, PWP2H, Periodic tryptophan protein 2 homolog) (MaxLight 650)
MBS6339269-02 5x 0.1 mL

PWP2, ID (PWP2, PWP2H, Periodic tryptophan protein 2 homolog) (MaxLight 650)

Sign In for Pricing
View Details
TUBA1C antibody
70R-21057 50 ul

TUBA1C antibody

Sign In for Pricing
View Details
Human A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit
DLR-ADAM9-Hu-48T 48 Tests

Human A Disintegrin And Metalloprotease 9 (ADAM9) ELISA Kit

Sign In for Pricing
View Details