Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

A8WUS5

Expression Region

1-85

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASQLIIYSAHVVLLVLVWLLAYTEVVPVLSYIPECAHCLVYYIYAAFNVIYGVATFNDC AEAKVELLQEIKQARAELKQKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maleimide-PEG2-AZD 100mg
A18949-100 100 mg

Maleimide-PEG2-AZD 100mg

Sign In for Pricing
View Details
HOXC6 Antibody
orb522586-01 50 μL

HOXC6 Antibody

Sign In for Pricing
View Details
HOXC6 Antibody
orb522586-02 100 µL

HOXC6 Antibody

Sign In for Pricing
View Details
PCDHA11 Protein Lysate (Rat) with C-HA Tag
36123036 100 µg

PCDHA11 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human hsa-miR-15a-3p miRNA Agomir
abx880471-01 5 nmol

Human hsa-miR-15a-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-15a-3p miRNA Agomir
abx880471-02 10 nmol

Human hsa-miR-15a-3p miRNA Agomir

Sign In for Pricing
View Details