Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3)

This Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3 (dpm-3) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Probable dolichol-phosphate mannosyltransferase subunit 3, DPM synthase complex subunit 3, Dolichol-phosphate mannose synthase subunit 3, Dolichyl-phosphate beta-D-mannosyltransferase subunit 3, Manno

UniProt

A8WUS5

Expression Region

1-85

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASQLIIYSAHVVLLVLVWLLAYTEVVPVLSYIPECAHCLVYYIYAAFNVIYGVATFNDC AEAKVELLQEIKQARAELKQKRIID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actl6a ORF Vector (Mouse) (pORF)
ORF038016 1.0 µg DNA

Actl6a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Sivelestat sodium hydrate (ONO-5046 sodium hydrate) 25mg
A16137-25 25 mg

Sivelestat sodium hydrate (ONO-5046 sodium hydrate) 25mg

Sign In for Pricing
View Details
pOTB7-MARK2 Plasmid
PVT26929 2 µg

pOTB7-MARK2 Plasmid

Sign In for Pricing
View Details
Phospho-PPP1CA (Thr320) Blocking Peptide
MBS9615987-01 1 mg

Phospho-PPP1CA (Thr320) Blocking Peptide

Sign In for Pricing
View Details
Phospho-PPP1CA (Thr320) Blocking Peptide
MBS9615987-02 5x 1 mg

Phospho-PPP1CA (Thr320) Blocking Peptide

Sign In for Pricing
View Details
Influenza B (Nucleoprotein) Mouse Monoclonal Antibody [Clone ID: InB204]
3IF18-InB204 1 mg

Influenza B (Nucleoprotein) Mouse Monoclonal Antibody [Clone ID: InB204]

Sign In for Pricing
View Details