Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0148 (AF_0148)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0148 (AF_0148) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0148

UniProt

O30089

Expression Region

1-85

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAARGWDEEVMKWLAVAICLAMVGMAVMPAFQPLNLAFELYYGHHESLPITAASAAYEG IVITATLAAAAATAELVHLLLQQFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf30 Rabbit Polyclonal Antibody (Biotin)
orb2086675 100 µL

CXorf30 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Transdermal Peptide (TD 1 (peptide) )
orb1692604-01 1 mg

Transdermal Peptide (TD 1 (peptide) )

Sign In for Pricing
View Details
Transdermal Peptide (TD 1 (peptide) )
orb1692604-02 5 mg

Transdermal Peptide (TD 1 (peptide) )

Sign In for Pricing
View Details
Transdermal Peptide (TD 1 (peptide) )
orb1692604-03 10 mg

Transdermal Peptide (TD 1 (peptide) )

Sign In for Pricing
View Details
Axl (phospho Tyr691) Antibody
A8079-01 50 μL

Axl (phospho Tyr691) Antibody

Sign In for Pricing
View Details
Axl (phospho Tyr691) Antibody
A8079-02 100 µL

Axl (phospho Tyr691) Antibody

Sign In for Pricing
View Details