Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0148 (AF_0148)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0148 (AF_0148) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0148

UniProt

O30089

Expression Region

1-85

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAARGWDEEVMKWLAVAICLAMVGMAVMPAFQPLNLAFELYYGHHESLPITAASAAYEG IVITATLAAAAATAELVHLLLQQFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA9C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20923061 1.0 µg DNA

FRA9C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Trafficking protein particle complex subunit 4 (TRAPPC4) Mouse ELISA Kit
H7007 96 Tests

Trafficking protein particle complex subunit 4 (TRAPPC4) Mouse ELISA Kit

Sign In for Pricing
View Details
MOAP1 Lentiviral Activation Particles (h)
sc-408271-LAC 200 µL

MOAP1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human Islet Antigen 2/IA-2 Fast ELISA
TBS3253 96 Well Plate

Human Islet Antigen 2/IA-2 Fast ELISA

Sign In for Pricing
View Details
Songoramine
orb1680689 5 mg

Songoramine

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Probable cytosol aminopeptidase (pepA)
MBS1404950-01 0.02 mg (E-Coli)

Recombinant Thermosynechococcus elongatus Probable cytosol aminopeptidase (pepA)

Sign In for Pricing
View Details