Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1482 (AF_1482)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1482 (AF_1482) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1482

UniProt

O28790

Expression Region

1-85

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSELERRAKICLSVVTFSTSYSLDAGVVVLAFLGIQRFRRSSKGAKIPEFLWVTWQSF IKVLSLLNGFVQHQKRYIFIRVCIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC33 Human Gene Knockout Kit (CRISPR)
KN420049 1 Kit

CCDC33 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL
BNC681026-100 1x 100 µL

CD70 (TNFS7/1026), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), CF405S conjugate, 0.1mg/mL
BNC043491-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL
BNC472868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fluorescent ADP Detection Kit
FLADP100-2 100 Tests

Fluorescent ADP Detection Kit

Sign In for Pricing
View Details
Stacking platform, small 10.5"x7.5" with flat mat (3.0"separation)
B3D-STACK 1 Each

Stacking platform, small 10.5"x7.5" with flat mat (3.0"separation)

Sign In for Pricing
View Details