Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1482 (AF_1482)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1482 (AF_1482) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1482

UniProt

O28790

Expression Region

1-85

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTSELERRAKICLSVVTFSTSYSLDAGVVVLAFLGIQRFRRSSKGAKIPEFLWVTWQSF IKVLSLLNGFVQHQKRYIFIRVCIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ciba Blue 2B (Technical Grade)
TRC-C535730-250MG 250 mg

Ciba Blue 2B (Technical Grade)

Sign In for Pricing
View Details
Human Nogo B receptor (NUS1) activation kit by CRISPRa
GA114569 1 Kit

Human Nogo B receptor (NUS1) activation kit by CRISPRa

Sign In for Pricing
View Details
2-fluoropropanedioic acid
TRC-F589573-50MG 50 mg

2-fluoropropanedioic acid

Sign In for Pricing
View Details
Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 488 conjugated (40 µg)
AS07 260-DL488 40 µg

Anti-H+ATPase | Plasma membrane H+ATPase (rabbit antibody), DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details
CD32A (FCGR2A) (NM_021642) Human Recombinant Protein
TP305786 20 µg

CD32A (FCGR2A) (NM_021642) Human Recombinant Protein

Sign In for Pricing
View Details
Supv3l1 Mouse Gene Knockout Kit (CRISPR)
KN516995 1 Kit

Supv3l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details