Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B0KRB3

Expression Region

1-85

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AMPD2 Antibody
NBP2-48971-25ul 25 µL

Rabbit Polyclonal AMPD2 Antibody

Sign In for Pricing
View Details
PIKE (G-9) HRP
sc-166864 HRP 200 µg/mL

PIKE (G-9) HRP

Sign In for Pricing
View Details
MDMA (Methylenedioxy-N-Methylamphetamine, Ecstacy) (APC)
171657-APC 100 µL

MDMA (Methylenedioxy-N-Methylamphetamine, Ecstacy) (APC)

Sign In for Pricing
View Details
Bovine CD302 antigen (CD302) ELISA kit
GTR10463822 96 Well

Bovine CD302 antigen (CD302) ELISA kit

Sign In for Pricing
View Details
Mouse Monoclonal GATA-4 Antibody (OTI9F9) [Janelia Fluor 549]
NBP2-70797JF549 0.1 mL

Mouse Monoclonal GATA-4 Antibody (OTI9F9) [Janelia Fluor 549]

Sign In for Pricing
View Details
WFS1 Human qPCR Template Standard (NM_006005)
HK209789 1 Kit

WFS1 Human qPCR Template Standard (NM_006005)

Sign In for Pricing
View Details