Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B0KRB3

Expression Region

1-85

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGDH Antibody (Center)
E45R09113G-4 50 µL

PHGDH Antibody (Center)

Sign In for Pricing
View Details
Anti-CoV2RBD-c2-mIgG2a
cov2rbdc2-mab10-3 3 x 100 µg

Anti-CoV2RBD-c2-mIgG2a

Sign In for Pricing
View Details
Ac-DL-β-Phe-OH
5-03307 5 g

Ac-DL-β-Phe-OH

Sign In for Pricing
View Details
pDNR-LIB-ANAPC10 Plasmid
PVT27007 2 µg

pDNR-LIB-ANAPC10 Plasmid

Sign In for Pricing
View Details
IFluor® 350 Anti-human CD47 Antibody *B6.H12*
10472010-AAT 100 Tests

IFluor® 350 Anti-human CD47 Antibody *B6.H12*

Sign In for Pricing
View Details
pCMV-SPORT6-RNF213 Plasmid
PVT14085 2 µg

pCMV-SPORT6-RNF213 Plasmid

Sign In for Pricing
View Details