Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B0KRB3

Expression Region

1-85

Origin

Pseudomonas putida (strain GB-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KB1 Antibody
orb671412-01 50 µg

RPS6KB1 Antibody

Sign In for Pricing
View Details
RPS6KB1 Antibody
orb671412-02 100 µg

RPS6KB1 Antibody

Sign In for Pricing
View Details
SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) (Biotin)
133269-Biotin 100 µL

SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) (Biotin)

Sign In for Pricing
View Details
Acetyl Kine Rabbit Polyclonal Antibody
ES1236-01 50 µL

Acetyl Kine Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetyl Kine Rabbit Polyclonal Antibody
ES1236-02 100 µL

Acetyl Kine Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chitinase 3 like protein 2 Rabbit pAb, Pacific Blue conjugated
orb2884552 100 µL

Chitinase 3 like protein 2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details