Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)
This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q3K436
Expression Region
1-85
Origin
Pseudomonas fluorescens (strain Pf0-1)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10366334 96 Well
Bovine CDK5 regulatory subunit associated protein 3 (CDK5RAP3) ELISA Kit
Sign In for Pricing
View Details 
EKU09737 96 Tests
Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) CLIA Kit
Sign In for Pricing
View Details 39164156 3x 1.0 µg DNA
RGD1311952 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details MBS6213880-01 0.1 mL
SENP7 (Sentrin-specific Protease 7, SUMO-1-specific Protease 2, Sentrin/SUMO-specific Protease SENP7, KIAA1707, SSP2, SUSP2) (MaxLight 550)
Sign In for Pricing
View Details