Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3K436

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EN-RAGE/S100A12 Antibody (OTI1D1) [Janelia Fluor 646]
NBP2-71276JF646 0.1 mL

Mouse Monoclonal EN-RAGE/S100A12 Antibody (OTI1D1) [Janelia Fluor 646]

Sign In for Pricing
View Details
2-Oxo-1H,2H,3H-imidazo[4,5-b]pyridine-5-carboxylic Acid
TRC-E590405-1G 1 g

2-Oxo-1H,2H,3H-imidazo[4,5-b]pyridine-5-carboxylic Acid

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934972-01 20 µg

Recombinant Roseiflexus castenholzii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Roseiflexus castenholzii NADH-quinone oxidoreductase subunit K (nuoK)
orb2934972-02 100 µg

Recombinant Roseiflexus castenholzii NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
NOD1 shRNA Plasmid (m)
sc-37280-SH 20 µg

NOD1 shRNA Plasmid (m)

Sign In for Pricing
View Details
TNNT3 (NM_001042781) Human Tagged Lenti ORF Clone
RC216700L4 10 µg

TNNT3 (NM_001042781) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details