Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3K436

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmp10, NT (Bone Morphogenetic Protein 10, BMP-10) (Biotin)
B2553-37F-Biotin 200 µL

Bmp10, NT (Bone Morphogenetic Protein 10, BMP-10) (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Lsp1 shRNA (UAS) - Lentiviral mouse Lsp1 shRNA (UAS, iRFP) (25)
GTR15246206 1 Vial

Lentiviral mouse Lsp1 shRNA (UAS) - Lentiviral mouse Lsp1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Uncharacterized protein KIAA0240 (KIAA0240) Mouse ELISA Kit
I1216 96 Tests

Uncharacterized protein KIAA0240 (KIAA0240) Mouse ELISA Kit

Sign In for Pricing
View Details
RGD1560927 sgRNA CRISPR Lentivector set (Rat)
K6541501 3x 1.0 µg

RGD1560927 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
UTP14A Rabbit pAb
E45R26224N-50 50 µL

UTP14A Rabbit pAb

Sign In for Pricing
View Details
Recombinant Giardia Lamblia GPI2 Protein (aa 1-263)
VAng-Cr4566-1mgEcoli 1 mg (E. coli)

Recombinant Giardia Lamblia GPI2 Protein (aa 1-263)

Sign In for Pricing
View Details