Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4K3A4

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1GALT1C1 Rabbit Polyclonal Antibody (RBITC)
orb1063033 100 µL

C1GALT1C1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
GALNS Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-13269R-PerCP-Cy5.5 100 µL

GALNS Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Pancreatic Lipase discontinued
512482 100 µg

Pancreatic Lipase discontinued

Sign In for Pricing
View Details
VDAC1 Protein Vector (Rat) (pPB-C-His)
PV315118 500 ng

VDAC1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Escherichia coli Trp operon repressor (trpR)
MBS1242549-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Trp operon repressor (trpR)

Sign In for Pricing
View Details
Recombinant Escherichia coli Trp operon repressor (trpR)
MBS1242549-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Trp operon repressor (trpR)

Sign In for Pricing
View Details