Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE)

This Recombinant Pseudomonas fluorescens ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4K3A4

Expression Region

1-85

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-1251-5p Vector
mh30085 500 ng

LentimiRa-Off-hsa-miR-1251-5p Vector

Sign In for Pricing
View Details
Vom2r65 ORF Vector (Rat) (pORF)
ORF078974 1.0 µg DNA

Vom2r65 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
YIPF2 (NM_024029) Human Over-expression Lysate
LC411407 20 µg

YIPF2 (NM_024029) Human Over-expression Lysate

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Human CD66b mAb
A26461-01 50 Tests

ABflo® 450 Rabbit anti-Human CD66b mAb

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Human CD66b mAb
A26461-02 100 Tests

ABflo® 450 Rabbit anti-Human CD66b mAb

Sign In for Pricing
View Details
ABflo® 450 Rabbit anti-Human CD66b mAb
A26461-03 200 Tests

ABflo® 450 Rabbit anti-Human CD66b mAb

Sign In for Pricing
View Details