Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q50830

Expression Region

1-85

Origin

Methanococcus vannielii

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGSVAWALINAGLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc55 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6658604 1.0 µg DNA

Lrrc55 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Human MTX1 Protein, N-His
AP92214 50 µg

Recombinant Human MTX1 Protein, N-His

Sign In for Pricing
View Details
PBX1 Recombinant Protein (Human)
RP082332 100 µg

PBX1 Recombinant Protein (Human)

Sign In for Pricing
View Details
hsa-miR-6759-3p miRNA Agomir
MBS8312877-01 5 nmol

hsa-miR-6759-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6759-3p miRNA Agomir
MBS8312877-02 10 nmol

hsa-miR-6759-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-6759-3p miRNA Agomir
MBS8312877-03 20 nmol

hsa-miR-6759-3p miRNA Agomir

Sign In for Pricing
View Details