Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q50830

Expression Region

1-85

Origin

Methanococcus vannielii

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGSVAWALINAGLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tjp1 shRNA (UAS) - Lentiviral mouse Tjp1 shRNA (UAS, iRFP) (25)
GTR15304433 1 Vial

Lentiviral mouse Tjp1 shRNA (UAS) - Lentiviral mouse Tjp1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Influenza A H2N2 NP protein, His Tag
E40VAG184 20 µg

Influenza A H2N2 NP protein, His Tag

Sign In for Pricing
View Details
PDPN (NM_198389) Human Tagged ORF Clone
RG204930 10 µg

PDPN (NM_198389) Human Tagged ORF Clone

Sign In for Pricing
View Details
n-Nonylbenzene-2,3,4,5,6-d5
N211096 10 mg

n-Nonylbenzene-2,3,4,5,6-d5

Sign In for Pricing
View Details
OTX2 Polyclonal Antibody
MBS8568738-01 0.1 mL

OTX2 Polyclonal Antibody

Sign In for Pricing
View Details
OTX2 Polyclonal Antibody
MBS8568738-02 0.1 mL (AF405L)

OTX2 Polyclonal Antibody

Sign In for Pricing
View Details