Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q50830

Expression Region

1-85

Origin

Methanococcus vannielii

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGSVAWALINAGLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSP Polyclonal Antibody
MBS9407290-01 0.05 mL

CSP Polyclonal Antibody

Sign In for Pricing
View Details
CSP Polyclonal Antibody
MBS9407290-02 0.1 mL

CSP Polyclonal Antibody

Sign In for Pricing
View Details
CSP Polyclonal Antibody
MBS9407290-03 5x 0.1 mL

CSP Polyclonal Antibody

Sign In for Pricing
View Details
Yeast ROM1 Rabbit Polyclonal Antibody (FITC)
orb2573077 200 µL

Yeast ROM1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human IL-23 ELISA Kit
E28L0034 96 Tests

Human IL-23 ELISA Kit

Sign In for Pricing
View Details
PHKG1 Rabbit Polyclonal Antibody
TA367186 100 µL

PHKG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details