Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q88BW9

Expression Region

1-85

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas aeruginosa Probable intracellular septation protein A (PLES_18661)
MBS1120307 Inquire

Recombinant Pseudomonas aeruginosa Probable intracellular septation protein A (PLES_18661)

Sign In for Pricing
View Details
L-Theanine
GRM10632-5G 1 unit

L-Theanine

Sign In for Pricing
View Details
VSIG8, CT (VSIG8, C1orf204, V-set and immunoglobulin domain-containing protein 8)
043785 200 µL

VSIG8, CT (VSIG8, C1orf204, V-set and immunoglobulin domain-containing protein 8)

Sign In for Pricing
View Details
Human Angiopoietin-2 (ANGPT2) ELISA Kit
abx573417 96 Well

Human Angiopoietin-2 (ANGPT2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TST Antibody [DyLight 594]
NBP2-98573DL594 0.1 mL

Rabbit Polyclonal TST Antibody [DyLight 594]

Sign In for Pricing
View Details
Mouse Monoclonal IL-5R alpha/CD125 Antibody (1036601) [CoraFluor 1]
FAB2531CL1 0.1 mL

Mouse Monoclonal IL-5R alpha/CD125 Antibody (1036601) [CoraFluor 1]

Sign In for Pricing
View Details