Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q88BW9

Expression Region

1-85

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF-06256142 25mg
A18872-25 25 mg

PF-06256142 25mg

Sign In for Pricing
View Details
Tmed9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4938607 1.0 µg DNA

Tmed9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Thymidine- 3', 5'- cyclic monophosphate (cTMP), sodium salt
T 005-05 5 µmol (~ 1.6 mg)

Thymidine- 3', 5'- cyclic monophosphate (cTMP), sodium salt

Sign In for Pricing
View Details
TLR8 Rabbit Polyclonal Antibody (PerCP)
orb2381500 100 µL

TLR8 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
MNX1/HLXB9 Rabbit Polyclonal Antibody (PE-Cy7)
orb871667 100 µL

MNX1/HLXB9 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Aminooxy-PEG1-azide
orb1989564-01 100 mg

Aminooxy-PEG1-azide

Sign In for Pricing
View Details