Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit c (atpE)

This Recombinant Pseudomonas putida ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q88BW9

Expression Region

1-85

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX3 Antibody / Paired box protein Pax-3
FY13236 100 µg

PAX3 Antibody / Paired box protein Pax-3

Sign In for Pricing
View Details
ATG2A, CT
366721 100 µg

ATG2A, CT

Sign In for Pricing
View Details
GIMAP8 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-8274R-BF647 100 µL

GIMAP8 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Human DBF4 Pre-designed siRNA Set B
SI003994B 1 Each

Human DBF4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Milk Fat Globule EGF Factor 8 (MFGE8) Antibody (Biotin)
abx105616-01 20 µg

Milk Fat Globule EGF Factor 8 (MFGE8) Antibody (Biotin)

Sign In for Pricing
View Details
Milk Fat Globule EGF Factor 8 (MFGE8) Antibody (Biotin)
abx105616-02 50 µg

Milk Fat Globule EGF Factor 8 (MFGE8) Antibody (Biotin)

Sign In for Pricing
View Details