Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Probable oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Probable oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

Q8DC44

Expression Region

1-85

Origin

Vibrio vulnificus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIGSLLVDAAALMVTGMGVVFIFLTILIFLVRLMSKLVPQEVPPPITAPKAVKNQANH TSTVSPQVVAAISAAIHQHRASVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

aCella - Tox - an assay designed to measure cell cytoxicity
CLATOX100-4 1000 Tests

aCella - Tox - an assay designed to measure cell cytoxicity

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (25-267) Mouse Monoclonal Antibody [Clone ID: AT1E12]
AM39003PU-N 100 µL

Apolipoprotein A I (APOA1) (25-267) Mouse Monoclonal Antibody [Clone ID: AT1E12]

Sign In for Pricing
View Details
Mouse Pcsk5 activation kit by CRISPRa
GA203128 1 Kit

Mouse Pcsk5 activation kit by CRISPRa

Sign In for Pricing
View Details
USP9X Rabbit Polyclonal Antibody
TA367357 100 µL

USP9X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Polyclonal Antibody
AP21108PU-N 100 µg

Tau (MAPT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF488A conjugate, 0.1mg/mL
BNC882683-100 1x 100 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details