Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable oxaloacetate decarboxylase gamma chain (oadG)

This Recombinant Probable oxaloacetate decarboxylase gamma chain (oadG) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Probable oxaloacetate decarboxylase gamma chain, EC= 4.1.1.3

UniProt

Q8DC44

Expression Region

1-85

Origin

Vibrio vulnificus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNIGSLLVDAAALMVTGMGVVFIFLTILIFLVRLMSKLVPQEVPPPITAPKAVKNQANH TSTVSPQVVAAISAAIHQHRASVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FOXP4 activation kit by CRISPRa
GA114564 1 Kit

Human FOXP4 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Isopropyl-3[4-(4-aminobenzyl)phenyl]hydantoin
TRC-I352960-10MG 10 mg

5-Isopropyl-3[4-(4-aminobenzyl)phenyl]hydantoin

Sign In for Pricing
View Details
2,4,5-Tribromo-phenol 1-Acetate
TRC-T897535-10MG 10 mg

2,4,5-Tribromo-phenol 1-Acetate

Sign In for Pricing
View Details
Caspase-8 Recombinant Rabbit Monoclonal Antibody [PSH04-77]
HA722181 100 µL

Caspase-8 Recombinant Rabbit Monoclonal Antibody [PSH04-77]

Sign In for Pricing
View Details
Recombinant Rhesus macaque CD155/PVR/NECL5 Protein (His Tag)
PKSQ050071-01 10 µg

Recombinant Rhesus macaque CD155/PVR/NECL5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rhesus macaque CD155/PVR/NECL5 Protein (His Tag)
PKSQ050071-02 50 µg

Recombinant Rhesus macaque CD155/PVR/NECL5 Protein (His Tag)

Sign In for Pricing
View Details