Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein C13orf44 (C13orf44)

This Recombinant Human Putative transmembrane protein C13orf44 (C13orf44) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Putative transmembrane protein C13orf44

UniProt

Q9BVW6

Expression Region

1-85

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAGERIDASQLPHRVLETRGHAISILFGFWTSFICDTYIVLAWISKIKGSPDVSASSDE PYARIQQSRRQCHAEEDQSQVPEAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL
BNC940673-500 1x 500 µL

Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF640R conjugate, 0.1mg/mL
BNC402098-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details