Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS)

This Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

UPF0410 protein ydaS

UniProt

P96594

Expression Region

1-85

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAI FPAIIGAAIFVFLLGLIFRGLRKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 Mouse Monoclonal Antibody [Clone ID: 5B11]
AM06693SU-N 100 µL

MSH6 Mouse Monoclonal Antibody [Clone ID: 5B11]

Sign In for Pricing
View Details
1,4-Cyclohexanediol (Cis/Trans Mixture)
TRC-C987060-50G 50 g

1,4-Cyclohexanediol (Cis/Trans Mixture)

Sign In for Pricing
View Details
RNF34 (NM_194271) Human Over-expression Lysate
LY403664 100 µg

RNF34 (NM_194271) Human Over-expression Lysate

Sign In for Pricing
View Details
DOG1 Rabbit Polyclonal Antibody
ER1901-30 100 µL

DOG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1-DT Human Gene Knockout Kit (CRISPR)
KN413725 1 Kit

CTBP1-DT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
27-Nor-25-ketocholesterol
TRC-N692095-50MG 50 mg

27-Nor-25-ketocholesterol

Sign In for Pricing
View Details