Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS)

This Recombinant Bacillus subtilis UPF0410 protein ydaS (ydaS) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

UPF0410 protein ydaS

UniProt

P96594

Expression Region

1-85

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAI FPAIIGAAIFVFLLGLIFRGLRKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF647 conjugate, 0.1mg/mL
BNC472409-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acalabrutinib-d3
TRC-A115606-5MG 5 mg

Acalabrutinib-d3

Sign In for Pricing
View Details
CD1a (O10), 0.2mg/mL
BNUB0667-500 1x 500 µL

CD1a (O10), 0.2mg/mL

Sign In for Pricing
View Details
Hexamidine-d12 Dihydrochloride
TRC-H294207-1MG 1 mg

Hexamidine-d12 Dihydrochloride

Sign In for Pricing
View Details
SH3 containing Grb 2 like 1 protein (SH3GL1) Goat Polyclonal Antibody
AP23746PU-N 100 µg

SH3 containing Grb 2 like 1 protein (SH3GL1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
BNP (NPPB) Mouse Monoclonal Antibody [Clone ID: 8D5B4C11]
AM06191SU-N 100 µL

BNP (NPPB) Mouse Monoclonal Antibody [Clone ID: 8D5B4C11]

Sign In for Pricing
View Details