Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR183C-A (YDR183C-A)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR183C-A (YDR183C-A) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YDR183C-A

UniProt

P0C5M3

Expression Region

1-85

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNHPRKVKFRVSSAKFICIYWFFCLYYKDGPILYTIYTTFLSHRYSYSTFIILRNTVAF LSFMYKHYYTHISYLTFYKSPKTFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF647 conjugate, 0.1mg/mL
BNC471468-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details