Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium difficile ATP synthase subunit c (atpE)

This Recombinant Clostridium difficile ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q180X0

Expression Region

1-86

Origin

Clostridium difficile (strain 630)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METAIVAAASAIGAGIAVATGIGAGIGQGIAAAKAAEAVGNQPEAKGDITSTLLLGVAIA ESSAIYGLVISIILLFVNPFFKYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD99 Antibody[HI156]
E-AB-F1339E-01 20 Tests

APC Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
APC Anti-Human CD99 Antibody[HI156]
E-AB-F1339E-02 100 Tests

APC Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
APC Anti-Human CD99 Antibody[HI156]
E-AB-F1339E-03 2x 100 Tests

APC Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI22F2]
TA801403BM 100 µL

ALK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI22F2]

Sign In for Pricing
View Details
DBCO-PEG4-PAB-MMAE
TRC-D489640-10MG 10 mg

DBCO-PEG4-PAB-MMAE

Sign In for Pricing
View Details
Human TTC39C activation kit by CRISPRa
GA114892 1 Kit

Human TTC39C activation kit by CRISPRa

Sign In for Pricing
View Details