Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium difficile ATP synthase subunit c (atpE)

This Recombinant Clostridium difficile ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q180X0

Expression Region

1-86

Origin

Clostridium difficile (strain 630)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METAIVAAASAIGAGIAVATGIGAGIGQGIAAAKAAEAVGNQPEAKGDITSTLLLGVAIA ESSAIYGLVISIILLFVNPFFKYLGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS807791 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM585]
AM50103PU-T 20 µg

Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM585]

Sign In for Pricing
View Details
Human NOXO1 activation kit by CRISPRa
GA114828 1 Kit

Human NOXO1 activation kit by CRISPRa

Sign In for Pricing
View Details
Clec4a2 Mouse Gene Knockout Kit (CRISPR)
KN503444 1 Kit

Clec4a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACPL2 (PXYLP1) (NM_152282) Human Over-expression Lysate
LY403459 100 µg

ACPL2 (PXYLP1) (NM_152282) Human Over-expression Lysate

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF740 conjugate, 0.1mg/mL
BNC742225-500 1x 500 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details