Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein TRIQK (Triqk)

This Recombinant Rat Protein TRIQK (Triqk) spans the amino acid sequence from region 1-86.

Product Specifications

Product Name Alternative

Protein TRIQK, Triple repetitive-sequence of QXXK/R protein homolog

UniProt

Q5EB66

Expression Region

1-86

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRKDSSTTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILA LLLAFYAFFYLRLSTNIDADLDPDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrvinium Pamaote
B1593-25 25 mg

Pyrvinium Pamaote

Sign In for Pricing
View Details
Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit
MBS452957-01 48 Tests

Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit

Sign In for Pricing
View Details
Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit
MBS452957-02 96 Tests

Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit

Sign In for Pricing
View Details
Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit
MBS452957-03 5x 96 Tests

Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit

Sign In for Pricing
View Details
Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit
MBS452957-04 10x 96 Tests

Bovine Vascular Endothelial Growth Factor 165 (VEGF165) ELISA Kit

Sign In for Pricing
View Details
NTN5 Peptide - C-terminal region
MBS3243577-01 0.1 mg

NTN5 Peptide - C-terminal region

Sign In for Pricing
View Details